PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01910.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 684aa    MW: 75278.8 Da    PI: 6.1858
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01910.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.32.3e-16395433240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+CnCkkskClk+YCeCfaag++C e C+C dC+N+ 
  Rsa1.0_01910.1_g00002.1 395 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNRP 433
                              689**********************************75 PP

2TCR52.88e-17480519140
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN  
  Rsa1.0_01910.1_g00002.1 480 RHKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNAF 519
                              589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.4E-19394435IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.515395520IPR005172CRC domain
PfamPF036385.7E-12397432IPR005172CRC domain
SMARTSM011145.7E-17480521IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.5E-12482518IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MDSSQKKKKI ETPTPKSKFE DSPVFNFINN LSPIETVRSI PTVQTFNSLS FTSPPPVFTS  60
PHASFHRESR FFRCHNSVER SKALESLDST QEVVGGASGE VDLNKDATLE EEEEEEEEET  120
SCGHVDSPPG PGDIVTQVLL DPSGGAPRGE DNASSSSEDV RKILDAQEEN DTPGCGRLMA  180
DAAELLVFRS PNDSEAFGCL VDKISSSERR FCAGVKLTKQ HDITKDVPAN DNEPLALVPN  240
QSSVLSLHRG SMRRRCLDFE VLGKRKKDIA DDDKQTLGDN KAESSSKCVV PGIGLHLNAI  300
PMSSKAIKIN TRHEGSASVE IQKSFPGSIT PVHSQDIMQE TLVQAETEAG EGLAVEEETP  360
KPLVFEELNQ DSLQKKKQVF FLEKRKVEEP GEGDSCKRCN CKKSKCLKLY CECFAAGVYC  420
IEPCSCVDCF NRPIHEDTVL ATRKQIESRN PLAFAPKVIR NSDSIMETSD DASKTPASAR  480
HKRGCNCKKS NCLKKYCECF QSGVGCSINC RCEGCKNAFG KKEAYLLAIM ESKQEEDVSK  540
IQQNSDLPKE VEQNPSSDQP STPLPPYRHM VVHQPFLSKN RLPPTQFFLG AGSSSFRKPD  600
RDLTQARIDK KPLETVAEDK TEIMPEILSD TPITTVKAIS PNSKRVSPPH IGSSESGSIL  660
GKRTNGRKLI LRSIPAFPSL NPNQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252266RRRCLDFEVLGKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587689.10.0PREDICTED: CRC domain-containing protein TSO1
RefseqXP_013693016.10.0PREDICTED: CRC domain-containing protein TSO1-like isoform X1
RefseqXP_013693017.10.0PREDICTED: CRC domain-containing protein TSO1-like isoform X1
RefseqXP_013693018.10.0PREDICTED: CRC domain-containing protein TSO1-like isoform X2
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078IU520.0A0A078IU52_BRANA; BnaCnng27630D protein
TrEMBLA0A0D3CH360.0A0A0D3CH36_BRAOL; Uncharacterized protein
STRINGBra033919.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein